• Contact
  • Press
Monday, May 18, 2026

No products in the cart.

  • Login
Healthy with Nedi
  • About
  • Recipes
    • All
    • Breakfast
    • Dessert
    • Dips & Spreads
    • Lunch & Dinner
    • Side Dishes
    • Skinny Cocktails
    • Smoothies
    • Soups & Salads
    • Warm Drinks
    Gluten-Free Keto Bread

    Gluten-Free Keto Bread

    Orange Banana Bread with Chocolate Chips

    Orange Banana Bread with Chocolate Chips

    grain-free-eggplant-miso

    Miso Glazed Eggplant

    Vegetable Linguine with Shrimp and Lemon Zest

    Vegetable Linguine with Shrimp and Lemon Zest

    Mushroom Soup with Buckwheat 

    Mushroom Soup with Buckwheat 

    Zucchini Roll with Smoked Salmon

    Zucchini Roll with Smoked Salmon

    Greek-Style Eggs with Leeks and Feta

    Greek-Style Eggs with Leeks and Feta

    Veggie-Packed Quinoa Salad with Roasted Salmon

    Veggie-Packed Quinoa Salad with Roasted Salmon

    Cinnamon Swirl Banana Bread

    Cinnamon Swirl Banana Bread

    • View All Recipies
    • Smoothies
    • Warm Drinks
    • Breakfast
    • Soups & Salads
    • Lunch & Dinner
    • Side Dishes
    • Dips & Spreads
    • Dessert
    • Skinny Cocktails
  • Work with Me
    • Nutrition
  • Travel
  • Cookbook
  • Blog
    • All
    • Fitness
    • Interviews
    • Nutrition
    • Restaurant Guides
    • Travel
    • Wellness
    • What I’m Loving
    Creamy Carrot Ginger Soup 

    Creamy Carrot Ginger Soup 

    vegan-crab-cakes

    Vegan Crab Cakes

    healthy, gut health, bone broth, grass fed beef, organic, soup, benefits, immune system, leaky gut, paleo, gluten free

    Wisdom Teeth Oral Surgery Recovery

    nedi, valentines, wine

    Valentine’s Day Gift Guide

    Ella’s Flats Delicious Crackers

    Ella’s Flats Delicious Crackers

    quinoa, salad, vegan, broccoli, asparagus

    11 Sources of Plant Based Protein

    • Fitness
    • Wellness
    • What I’m Loving
    • Interviews
  • Shop
    • Shop My Products
    • Shop Nedi’s Favorites
No Result
View All Result
  • About
  • Recipes
    • All
    • Breakfast
    • Dessert
    • Dips & Spreads
    • Lunch & Dinner
    • Side Dishes
    • Skinny Cocktails
    • Smoothies
    • Soups & Salads
    • Warm Drinks
    Gluten-Free Keto Bread

    Gluten-Free Keto Bread

    Orange Banana Bread with Chocolate Chips

    Orange Banana Bread with Chocolate Chips

    grain-free-eggplant-miso

    Miso Glazed Eggplant

    Vegetable Linguine with Shrimp and Lemon Zest

    Vegetable Linguine with Shrimp and Lemon Zest

    Mushroom Soup with Buckwheat 

    Mushroom Soup with Buckwheat 

    Zucchini Roll with Smoked Salmon

    Zucchini Roll with Smoked Salmon

    Greek-Style Eggs with Leeks and Feta

    Greek-Style Eggs with Leeks and Feta

    Veggie-Packed Quinoa Salad with Roasted Salmon

    Veggie-Packed Quinoa Salad with Roasted Salmon

    Cinnamon Swirl Banana Bread

    Cinnamon Swirl Banana Bread

    • View All Recipies
    • Smoothies
    • Warm Drinks
    • Breakfast
    • Soups & Salads
    • Lunch & Dinner
    • Side Dishes
    • Dips & Spreads
    • Dessert
    • Skinny Cocktails
  • Work with Me
    • Nutrition
  • Travel
  • Cookbook
  • Blog
    • All
    • Fitness
    • Interviews
    • Nutrition
    • Restaurant Guides
    • Travel
    • Wellness
    • What I’m Loving
    Creamy Carrot Ginger Soup 

    Creamy Carrot Ginger Soup 

    vegan-crab-cakes

    Vegan Crab Cakes

    healthy, gut health, bone broth, grass fed beef, organic, soup, benefits, immune system, leaky gut, paleo, gluten free

    Wisdom Teeth Oral Surgery Recovery

    nedi, valentines, wine

    Valentine’s Day Gift Guide

    Ella’s Flats Delicious Crackers

    Ella’s Flats Delicious Crackers

    quinoa, salad, vegan, broccoli, asparagus

    11 Sources of Plant Based Protein

    • Fitness
    • Wellness
    • What I’m Loving
    • Interviews
  • Shop
    • Shop My Products
    • Shop Nedi’s Favorites
No Result
View All Result
Healthy with Nedi
No Result
View All Result
Home Recipes Breakfast

Savory Ham and Cheese Crepes

Nedi by Nedi
October 13, 2019
in Breakfast
53 3
0
Savory Ham and Cheese Crepes
87
SHARES
400
VIEWS
Share on FacebookShare on TwitterShare on Pinterest

I absolutely love crepes, they bring back a lot of childhood memories. My mom always made crepes for my friends and I in the morning after a sleepover. We used to compete how many we can each eat before being in a food coma, lol! These savory crepes also remind me of a healthier version of a very tasty croque-madame… yum. The batter in these crepes is made with organic flour, but for those of you who are gluten free, a gluten free flour can be used as well.

collage

Savory Ham and Cheese Crepes

Makes 12 Crepes

INGREDIENTS

For The Batter:

  • 1 1/2 cups gluten free flour
  • 1/2 cup water
  • 1 tbsp ghee, melted
  • 1 cup coconut milk
  • 5 eggs, whisked
  • pinch of sea salt
  • pinch of coconut sugar

Toppings:

  • diced tomatos
  • diced organic ham
  • shredded mozzarella cheese
  • crumbled feta cheese
  • 1 fried egg (optional)

DIRECTIONS

  • STEP 1. Combined all of the ingredients for the batter and beat with a fork until smooth.
  • STEP 2. Heat a large skillet over high heat and spray with coconut oil.
  • STEP 3. Using a ladle, pour one full ladle into the skillet and twist it around so it spreads evenly.
  • STEP 4. Cook for 20-30 seconds and flip over. Cook the other side for another 20 seconds and sprinkle half the side of the crepe with cheese, ham and tomato. Transfer to a plate and flip one side to the other and again, forming a triangle.
  • STEP 5. Repeat steps 2 to 4 for the rest of the crepes.
  • STEP 6. If you like eggs, and want a more filling breakfast, serve with a fried egg on top and enjoy!
Tags: breakfastcheesecrepeseggeggshamkidssavory
Previous Post

The Healthy with Nedi Holiday Gift Guide

Next Post

Stuffed Cabbage Leaves

Next Post
Stuffed Cabbage Leaves

Stuffed Cabbage Leaves

Leave a Reply Cancel reply

Your email address will not be published. Required fields are marked *

Newsletter

Follow & Like

Healthywithnedi.com Notes

All content on healthywithnedi.com is licensed and the original creation and property of Healthy with Nedi LLC, unless otherwise noted. You may use recipes from healthywithnedi.com provided that usage adheres to the following license criteria: I the recipe is credited to healthywithnedi.com by linking back to the original recipe at https://healthywithnedi.com; and II you may not use any recipes for commercial purposes.

As an Amazon Associate, I earn from qualifying purchases.

Photos on healthywithnedi.com may not be used without prior consent.

Recent Posts

Gluten-Free Keto Bread

Gluten-Free Keto Bread

April 10, 2023
Orange Banana Bread with Chocolate Chips

Orange Banana Bread with Chocolate Chips

February 21, 2023
grain-free-eggplant-miso

Miso Glazed Eggplant

November 10, 2022

Navigate

  • Privacy Policy
  • Contact
  • Press

Browse by Category

  • Blog
  • Breakfast
  • Dessert
  • Dinner
  • Dips & Spreads
  • Fitness
  • Greece
  • Interviews
  • Lunch & Dinner
  • Nutrition
  • Recipes
  • Restaurant Guides
  • Side Dishes
  • Skinny Cocktails
  • Smoothies
  • Soups & Salads
  • Travel
  • Uncategorized
  • Vegetarian
  • Warm Drinks
  • Wellness
  • What I’m Loving

© 2022 Healthy with Nedi. All Rights Reserved.

No Result
View All Result
  • About
  • Recipes
    • Breakfast
    • Dessert
    • Dips & Spreads
    • Lunch & Dinner
    • Side Dishes
    • Skinny Cocktails
    • Smoothies
    • Soups & Salads
    • Warm Drinks
  • Work with Me
    • Nutrition
  • Travel
  • Cookbook
  • Blog
    • Fitness
    • Wellness
    • What I’m Loving
    • Interviews
  • Shop
    • Shop Nedi’s Favorites
  • Contact
  • Press

© 2022 Healthy with Nedi. All Rights Reserved.

Welcome Back!

Login to your account below

Forgotten Password?

Retrieve your password

Please enter your username or email address to reset your password.

Log In
Order My New Cookbook Today!
Order Today!
The Mediterranean Meal Plan Cookbook