• Contact
  • Press
Wednesday, August 19, 2026

No products in the cart.

  • Login
Healthy with Nedi
  • About
  • Recipes
    • All
    • Breakfast
    • Dessert
    • Dips & Spreads
    • Lunch & Dinner
    • Side Dishes
    • Skinny Cocktails
    • Smoothies
    • Soups & Salads
    • Warm Drinks
    Gluten-Free Keto Bread

    Gluten-Free Keto Bread

    Orange Banana Bread with Chocolate Chips

    Orange Banana Bread with Chocolate Chips

    grain-free-eggplant-miso

    Miso Glazed Eggplant

    Vegetable Linguine with Shrimp and Lemon Zest

    Vegetable Linguine with Shrimp and Lemon Zest

    Mushroom Soup with Buckwheat 

    Mushroom Soup with Buckwheat 

    Zucchini Roll with Smoked Salmon

    Zucchini Roll with Smoked Salmon

    Greek-Style Eggs with Leeks and Feta

    Greek-Style Eggs with Leeks and Feta

    Veggie-Packed Quinoa Salad with Roasted Salmon

    Veggie-Packed Quinoa Salad with Roasted Salmon

    Cinnamon Swirl Banana Bread

    Cinnamon Swirl Banana Bread

    • View All Recipies
    • Smoothies
    • Warm Drinks
    • Breakfast
    • Soups & Salads
    • Lunch & Dinner
    • Side Dishes
    • Dips & Spreads
    • Dessert
    • Skinny Cocktails
  • Work with Me
    • Nutrition
  • Travel
  • Cookbook
  • Blog
    • All
    • Fitness
    • Interviews
    • Nutrition
    • Restaurant Guides
    • Travel
    • Wellness
    • What I’m Loving
    Creamy Carrot Ginger Soup 

    Creamy Carrot Ginger Soup 

    vegan-crab-cakes

    Vegan Crab Cakes

    healthy, gut health, bone broth, grass fed beef, organic, soup, benefits, immune system, leaky gut, paleo, gluten free

    Wisdom Teeth Oral Surgery Recovery

    nedi, valentines, wine

    Valentine’s Day Gift Guide

    Ella’s Flats Delicious Crackers

    Ella’s Flats Delicious Crackers

    quinoa, salad, vegan, broccoli, asparagus

    11 Sources of Plant Based Protein

    • Fitness
    • Wellness
    • What I’m Loving
    • Interviews
  • Shop
    • Shop My Products
    • Shop Nedi’s Favorites
No Result
View All Result
  • About
  • Recipes
    • All
    • Breakfast
    • Dessert
    • Dips & Spreads
    • Lunch & Dinner
    • Side Dishes
    • Skinny Cocktails
    • Smoothies
    • Soups & Salads
    • Warm Drinks
    Gluten-Free Keto Bread

    Gluten-Free Keto Bread

    Orange Banana Bread with Chocolate Chips

    Orange Banana Bread with Chocolate Chips

    grain-free-eggplant-miso

    Miso Glazed Eggplant

    Vegetable Linguine with Shrimp and Lemon Zest

    Vegetable Linguine with Shrimp and Lemon Zest

    Mushroom Soup with Buckwheat 

    Mushroom Soup with Buckwheat 

    Zucchini Roll with Smoked Salmon

    Zucchini Roll with Smoked Salmon

    Greek-Style Eggs with Leeks and Feta

    Greek-Style Eggs with Leeks and Feta

    Veggie-Packed Quinoa Salad with Roasted Salmon

    Veggie-Packed Quinoa Salad with Roasted Salmon

    Cinnamon Swirl Banana Bread

    Cinnamon Swirl Banana Bread

    • View All Recipies
    • Smoothies
    • Warm Drinks
    • Breakfast
    • Soups & Salads
    • Lunch & Dinner
    • Side Dishes
    • Dips & Spreads
    • Dessert
    • Skinny Cocktails
  • Work with Me
    • Nutrition
  • Travel
  • Cookbook
  • Blog
    • All
    • Fitness
    • Interviews
    • Nutrition
    • Restaurant Guides
    • Travel
    • Wellness
    • What I’m Loving
    Creamy Carrot Ginger Soup 

    Creamy Carrot Ginger Soup 

    vegan-crab-cakes

    Vegan Crab Cakes

    healthy, gut health, bone broth, grass fed beef, organic, soup, benefits, immune system, leaky gut, paleo, gluten free

    Wisdom Teeth Oral Surgery Recovery

    nedi, valentines, wine

    Valentine’s Day Gift Guide

    Ella’s Flats Delicious Crackers

    Ella’s Flats Delicious Crackers

    quinoa, salad, vegan, broccoli, asparagus

    11 Sources of Plant Based Protein

    • Fitness
    • Wellness
    • What I’m Loving
    • Interviews
  • Shop
    • Shop My Products
    • Shop Nedi’s Favorites
No Result
View All Result
Healthy with Nedi
No Result
View All Result
Home Recipes Warm Drinks

Matcha Latte

Nedi by Nedi
February 22, 2016
in Warm Drinks
55 1
6
matcha, latte, vegan, gluten free, warm drinks, healthy, tea, caffeine
95
SHARES
400
VIEWS
Share on FacebookShare on TwitterShare on Pinterest

Matcha is highly concentrated in caffeine, 1 serving of matcha is equivalent to 10 cups of regular green tea. It is very high in antioxidants, amino acids, and chlorophyll, which is responsible for it’s beautiful bright green color. L-theanine, the amino acids contained in matcha tea is known to have a relaxing effect on the mind and body. Amongst its many health benefits, matcha lowers cholesterol and blood sugar. Matcha helps clear up acne, and has been used for centuries by Japanese women as a facial mask.

Matcha Latte

Serves 1

INGREDIENTS matcha, latte, vegan, gluten free, warm drinks, healthy, tea, caffeine

  • 1 tsp matcha
  • 1/2 cup hot water
  • 1 cup coconut milk
  • 1 tsp raw honey

DIRECTIONS

STEP 1. Simmer milk in a sauce pan over low to medium heat.

STEP 2. Add all of the ingredients and stir with a spoon. Place milk frother on top and allow to froth until desired amount of foams formed. Serve immediately.

Tags: antioxidantscaffeinegluten freehealthylattematchateaveganwarm drinks
Previous Post

Dirty Dozen & Clean Fifteen

Next Post

Slow Cooked Israeli Chicken

Next Post
Slow Cooked Israeli Chicken, stew, delicious, lunch, dinner, poultry, healthy, warming, comfort food, potatoes, gluten free

Slow Cooked Israeli Chicken

Comments 6

  1. Sonya says:
    8 years ago

    Hi Nedi, I love your posts. Always so informative and interesting. 🙂

    Reply
    • Nedi says:
      8 years ago

      Thank you Sonya!

      Reply
  2. Emily says:
    8 years ago

    Hi Nedi! Love your posts! What is your preferred matcha powder and coconut milk?

    Reply
    • Nedi says:
      8 years ago

      Thanks Emily! There are many great options when it comes to matcha, just make sure it is unsweetened and look for a high grade. As for the coconut milk – I love Califia Farms.

      Reply
  3. Nicoleta Schileru says:
    6 years ago

    I tried Matcha a few times and I felt so bad because I wasn’t into the taste. I thought what a shame, this really cool looking superfood and I can’t drink it. Well, not anymore! Thanks to you, I now can enjoy matcha! Thank you!

    Reply
    • Nedi says:
      6 years ago

      I am so happy to hear that!! Love matcha too!

      Reply

Leave a Reply Cancel reply

Your email address will not be published. Required fields are marked *

Newsletter

Follow & Like

Healthywithnedi.com Notes

All content on healthywithnedi.com is licensed and the original creation and property of Healthy with Nedi LLC, unless otherwise noted. You may use recipes from healthywithnedi.com provided that usage adheres to the following license criteria: I the recipe is credited to healthywithnedi.com by linking back to the original recipe at https://healthywithnedi.com; and II you may not use any recipes for commercial purposes.

As an Amazon Associate, I earn from qualifying purchases.

Photos on healthywithnedi.com may not be used without prior consent.

Recent Posts

Gluten-Free Keto Bread

Gluten-Free Keto Bread

April 10, 2023
Orange Banana Bread with Chocolate Chips

Orange Banana Bread with Chocolate Chips

February 21, 2023
grain-free-eggplant-miso

Miso Glazed Eggplant

November 10, 2022

Navigate

  • Privacy Policy
  • Contact
  • Press

Browse by Category

  • Blog
  • Breakfast
  • Dessert
  • Dinner
  • Dips & Spreads
  • Fitness
  • Greece
  • Interviews
  • Lunch & Dinner
  • Nutrition
  • Recipes
  • Restaurant Guides
  • Side Dishes
  • Skinny Cocktails
  • Smoothies
  • Soups & Salads
  • Travel
  • Uncategorized
  • Vegetarian
  • Warm Drinks
  • Wellness
  • What I’m Loving

© 2022 Healthy with Nedi. All Rights Reserved.

No Result
View All Result
  • About
  • Recipes
    • Breakfast
    • Dessert
    • Dips & Spreads
    • Lunch & Dinner
    • Side Dishes
    • Skinny Cocktails
    • Smoothies
    • Soups & Salads
    • Warm Drinks
  • Work with Me
    • Nutrition
  • Travel
  • Cookbook
  • Blog
    • Fitness
    • Wellness
    • What I’m Loving
    • Interviews
  • Shop
    • Shop Nedi’s Favorites
  • Contact
  • Press

© 2022 Healthy with Nedi. All Rights Reserved.

Welcome Back!

Login to your account below

Forgotten Password?

Retrieve your password

Please enter your username or email address to reset your password.

Log In
Order My New Cookbook Today!
Order Today!
The Mediterranean Meal Plan Cookbook