• Contact
  • Press
Thursday, August 20, 2026

No products in the cart.

  • Login
Healthy with Nedi
  • About
  • Recipes
    • All
    • Breakfast
    • Dessert
    • Dips & Spreads
    • Lunch & Dinner
    • Side Dishes
    • Skinny Cocktails
    • Smoothies
    • Soups & Salads
    • Warm Drinks
    Gluten-Free Keto Bread

    Gluten-Free Keto Bread

    Orange Banana Bread with Chocolate Chips

    Orange Banana Bread with Chocolate Chips

    grain-free-eggplant-miso

    Miso Glazed Eggplant

    Vegetable Linguine with Shrimp and Lemon Zest

    Vegetable Linguine with Shrimp and Lemon Zest

    Mushroom Soup with Buckwheat 

    Mushroom Soup with Buckwheat 

    Zucchini Roll with Smoked Salmon

    Zucchini Roll with Smoked Salmon

    Greek-Style Eggs with Leeks and Feta

    Greek-Style Eggs with Leeks and Feta

    Veggie-Packed Quinoa Salad with Roasted Salmon

    Veggie-Packed Quinoa Salad with Roasted Salmon

    Cinnamon Swirl Banana Bread

    Cinnamon Swirl Banana Bread

    • View All Recipies
    • Smoothies
    • Warm Drinks
    • Breakfast
    • Soups & Salads
    • Lunch & Dinner
    • Side Dishes
    • Dips & Spreads
    • Dessert
    • Skinny Cocktails
  • Work with Me
    • Nutrition
  • Travel
  • Cookbook
  • Blog
    • All
    • Fitness
    • Interviews
    • Nutrition
    • Restaurant Guides
    • Travel
    • Wellness
    • What I’m Loving
    Creamy Carrot Ginger Soup 

    Creamy Carrot Ginger Soup 

    vegan-crab-cakes

    Vegan Crab Cakes

    healthy, gut health, bone broth, grass fed beef, organic, soup, benefits, immune system, leaky gut, paleo, gluten free

    Wisdom Teeth Oral Surgery Recovery

    nedi, valentines, wine

    Valentine’s Day Gift Guide

    Ella’s Flats Delicious Crackers

    Ella’s Flats Delicious Crackers

    quinoa, salad, vegan, broccoli, asparagus

    11 Sources of Plant Based Protein

    • Fitness
    • Wellness
    • What I’m Loving
    • Interviews
  • Shop
    • Shop My Products
    • Shop Nedi’s Favorites
No Result
View All Result
  • About
  • Recipes
    • All
    • Breakfast
    • Dessert
    • Dips & Spreads
    • Lunch & Dinner
    • Side Dishes
    • Skinny Cocktails
    • Smoothies
    • Soups & Salads
    • Warm Drinks
    Gluten-Free Keto Bread

    Gluten-Free Keto Bread

    Orange Banana Bread with Chocolate Chips

    Orange Banana Bread with Chocolate Chips

    grain-free-eggplant-miso

    Miso Glazed Eggplant

    Vegetable Linguine with Shrimp and Lemon Zest

    Vegetable Linguine with Shrimp and Lemon Zest

    Mushroom Soup with Buckwheat 

    Mushroom Soup with Buckwheat 

    Zucchini Roll with Smoked Salmon

    Zucchini Roll with Smoked Salmon

    Greek-Style Eggs with Leeks and Feta

    Greek-Style Eggs with Leeks and Feta

    Veggie-Packed Quinoa Salad with Roasted Salmon

    Veggie-Packed Quinoa Salad with Roasted Salmon

    Cinnamon Swirl Banana Bread

    Cinnamon Swirl Banana Bread

    • View All Recipies
    • Smoothies
    • Warm Drinks
    • Breakfast
    • Soups & Salads
    • Lunch & Dinner
    • Side Dishes
    • Dips & Spreads
    • Dessert
    • Skinny Cocktails
  • Work with Me
    • Nutrition
  • Travel
  • Cookbook
  • Blog
    • All
    • Fitness
    • Interviews
    • Nutrition
    • Restaurant Guides
    • Travel
    • Wellness
    • What I’m Loving
    Creamy Carrot Ginger Soup 

    Creamy Carrot Ginger Soup 

    vegan-crab-cakes

    Vegan Crab Cakes

    healthy, gut health, bone broth, grass fed beef, organic, soup, benefits, immune system, leaky gut, paleo, gluten free

    Wisdom Teeth Oral Surgery Recovery

    nedi, valentines, wine

    Valentine’s Day Gift Guide

    Ella’s Flats Delicious Crackers

    Ella’s Flats Delicious Crackers

    quinoa, salad, vegan, broccoli, asparagus

    11 Sources of Plant Based Protein

    • Fitness
    • Wellness
    • What I’m Loving
    • Interviews
  • Shop
    • Shop My Products
    • Shop Nedi’s Favorites
No Result
View All Result
Healthy with Nedi
No Result
View All Result
Home Recipes Breakfast

Chocolate Chip Pancakes

Nedi by Nedi
March 3, 2019
in Breakfast
54 2
3
chocolate-chip-pancakes
107
SHARES
400
VIEWS
Share on FacebookShare on TwitterShare on Pinterest

The perfect stack of chocolate chip pancakes for a weekend brunch. The flavor combination of chocolate and coconut is exquisite. I paired these with sliced banana and fiber syrup to make it even more delicious! You can use honey or maple syrup and play around with the toppings as you like. I recommend using a pancake pan that has 4 even round holes so the pancakes come out perfect.

chocolate-chip-pancakes

Chocolate Chip Pancakes

Serves 2

INGREDIENTS

  • 2 eggs
  • ½ cup coconut milk
  • 1 tbsp sukrin fiber gold syrup
  • ½ tsp vanilla extract
  • 1/4 cup coconut flour
  • 1/2 tsp baking powder
  • ¼ cup chocolate chips
  • Coconut oil cooking spray

Toppings:

  • sliced banana
  • chocolate chips
  • fiber gold syrup
  • blueberries

DIRECTIONS

  • STEP 1. Whisk the eggs into a mixing bowl and add the coconut milk, fiber syrup, coconut flour, baking powder and chocolate chips. Mix until well combines.
  • STEP 2. Heat a skillet over medium heat and spray with coconut oil.
  • STEP 3. Pour the pancake mixture so it forms four round pancakes. Cook for about 5 minutes, until small bubbles start to form. Flip over and cook for 30-60 seconds.
  • STEP 4. Serve with banana, chocolate chips, fiber syrup and blueberries.

chocolate-chip-pancakes

Tags: bananabreakfastbrunchChocolate Chip Pancakescoconutgluten freehealthykid-friendlypancakeweekend brunch
Previous Post

Baby Spinach Salad

Next Post

Croque Madame Waffle

Next Post
Croque Madame Waffle

Croque Madame Waffle

Comments 3

  1. Anne Weaver says:
    7 years ago

    Hi Nedi. I love your site and have tried many of your recipes, all of which have been yummy . However, I made the chocolate chip pancakes for Sunday breakfast this morning and had real problems. Are the ingredient quantities correct as I stuck to them and the mixture was thicker than cake mixture! I had to add considerably more coconut milk to make it into the consistency of pancake mixture. Even then, when cooking the pancakes they wouldn’t bind so unable to turn them over as they just fell apart and looked like scrambled eggs . It’s a real shame as I had a little taste of one and they were nice . Can you advise please. P.S. vanilla essence shows in the ingredients but not in the method? Kindest regards. Anne.

    Reply
  2. tricia says:
    6 years ago

    hi I am looking for recipes to do with Candida. Thanks Tricia in Hawaii

    Reply
    • Nedi says:
      6 years ago

      Hi Tricia,

      You can check out these two articles:
      https://healthywithnedi.com/candida-diet/
      https://healthywithnedi.com/cooking-for-candida/

      Reply

Leave a Reply Cancel reply

Your email address will not be published. Required fields are marked *

Newsletter

Follow & Like

Healthywithnedi.com Notes

All content on healthywithnedi.com is licensed and the original creation and property of Healthy with Nedi LLC, unless otherwise noted. You may use recipes from healthywithnedi.com provided that usage adheres to the following license criteria: I the recipe is credited to healthywithnedi.com by linking back to the original recipe at https://healthywithnedi.com; and II you may not use any recipes for commercial purposes.

As an Amazon Associate, I earn from qualifying purchases.

Photos on healthywithnedi.com may not be used without prior consent.

Recent Posts

Gluten-Free Keto Bread

Gluten-Free Keto Bread

April 10, 2023
Orange Banana Bread with Chocolate Chips

Orange Banana Bread with Chocolate Chips

February 21, 2023
grain-free-eggplant-miso

Miso Glazed Eggplant

November 10, 2022

Navigate

  • Privacy Policy
  • Contact
  • Press

Browse by Category

  • Blog
  • Breakfast
  • Dessert
  • Dinner
  • Dips & Spreads
  • Fitness
  • Greece
  • Interviews
  • Lunch & Dinner
  • Nutrition
  • Recipes
  • Restaurant Guides
  • Side Dishes
  • Skinny Cocktails
  • Smoothies
  • Soups & Salads
  • Travel
  • Uncategorized
  • Vegetarian
  • Warm Drinks
  • Wellness
  • What I’m Loving

© 2022 Healthy with Nedi. All Rights Reserved.

No Result
View All Result
  • About
  • Recipes
    • Breakfast
    • Dessert
    • Dips & Spreads
    • Lunch & Dinner
    • Side Dishes
    • Skinny Cocktails
    • Smoothies
    • Soups & Salads
    • Warm Drinks
  • Work with Me
    • Nutrition
  • Travel
  • Cookbook
  • Blog
    • Fitness
    • Wellness
    • What I’m Loving
    • Interviews
  • Shop
    • Shop Nedi’s Favorites
  • Contact
  • Press

© 2022 Healthy with Nedi. All Rights Reserved.

Welcome Back!

Login to your account below

Forgotten Password?

Retrieve your password

Please enter your username or email address to reset your password.

Log In
Order My New Cookbook Today!
Order Today!
The Mediterranean Meal Plan Cookbook