• Contact
  • Press
Thursday, August 20, 2026

No products in the cart.

  • Login
Healthy with Nedi
  • About
  • Recipes
    • All
    • Breakfast
    • Dessert
    • Dips & Spreads
    • Lunch & Dinner
    • Side Dishes
    • Skinny Cocktails
    • Smoothies
    • Soups & Salads
    • Warm Drinks
    Gluten-Free Keto Bread

    Gluten-Free Keto Bread

    Orange Banana Bread with Chocolate Chips

    Orange Banana Bread with Chocolate Chips

    grain-free-eggplant-miso

    Miso Glazed Eggplant

    Vegetable Linguine with Shrimp and Lemon Zest

    Vegetable Linguine with Shrimp and Lemon Zest

    Mushroom Soup with Buckwheat 

    Mushroom Soup with Buckwheat 

    Zucchini Roll with Smoked Salmon

    Zucchini Roll with Smoked Salmon

    Greek-Style Eggs with Leeks and Feta

    Greek-Style Eggs with Leeks and Feta

    Veggie-Packed Quinoa Salad with Roasted Salmon

    Veggie-Packed Quinoa Salad with Roasted Salmon

    Cinnamon Swirl Banana Bread

    Cinnamon Swirl Banana Bread

    • View All Recipies
    • Smoothies
    • Warm Drinks
    • Breakfast
    • Soups & Salads
    • Lunch & Dinner
    • Side Dishes
    • Dips & Spreads
    • Dessert
    • Skinny Cocktails
  • Work with Me
    • Nutrition
  • Travel
  • Cookbook
  • Blog
    • All
    • Fitness
    • Interviews
    • Nutrition
    • Restaurant Guides
    • Travel
    • Wellness
    • What I’m Loving
    Creamy Carrot Ginger Soup 

    Creamy Carrot Ginger Soup 

    vegan-crab-cakes

    Vegan Crab Cakes

    healthy, gut health, bone broth, grass fed beef, organic, soup, benefits, immune system, leaky gut, paleo, gluten free

    Wisdom Teeth Oral Surgery Recovery

    nedi, valentines, wine

    Valentine’s Day Gift Guide

    Ella’s Flats Delicious Crackers

    Ella’s Flats Delicious Crackers

    quinoa, salad, vegan, broccoli, asparagus

    11 Sources of Plant Based Protein

    • Fitness
    • Wellness
    • What I’m Loving
    • Interviews
  • Shop
    • Shop My Products
    • Shop Nedi’s Favorites
No Result
View All Result
  • About
  • Recipes
    • All
    • Breakfast
    • Dessert
    • Dips & Spreads
    • Lunch & Dinner
    • Side Dishes
    • Skinny Cocktails
    • Smoothies
    • Soups & Salads
    • Warm Drinks
    Gluten-Free Keto Bread

    Gluten-Free Keto Bread

    Orange Banana Bread with Chocolate Chips

    Orange Banana Bread with Chocolate Chips

    grain-free-eggplant-miso

    Miso Glazed Eggplant

    Vegetable Linguine with Shrimp and Lemon Zest

    Vegetable Linguine with Shrimp and Lemon Zest

    Mushroom Soup with Buckwheat 

    Mushroom Soup with Buckwheat 

    Zucchini Roll with Smoked Salmon

    Zucchini Roll with Smoked Salmon

    Greek-Style Eggs with Leeks and Feta

    Greek-Style Eggs with Leeks and Feta

    Veggie-Packed Quinoa Salad with Roasted Salmon

    Veggie-Packed Quinoa Salad with Roasted Salmon

    Cinnamon Swirl Banana Bread

    Cinnamon Swirl Banana Bread

    • View All Recipies
    • Smoothies
    • Warm Drinks
    • Breakfast
    • Soups & Salads
    • Lunch & Dinner
    • Side Dishes
    • Dips & Spreads
    • Dessert
    • Skinny Cocktails
  • Work with Me
    • Nutrition
  • Travel
  • Cookbook
  • Blog
    • All
    • Fitness
    • Interviews
    • Nutrition
    • Restaurant Guides
    • Travel
    • Wellness
    • What I’m Loving
    Creamy Carrot Ginger Soup 

    Creamy Carrot Ginger Soup 

    vegan-crab-cakes

    Vegan Crab Cakes

    healthy, gut health, bone broth, grass fed beef, organic, soup, benefits, immune system, leaky gut, paleo, gluten free

    Wisdom Teeth Oral Surgery Recovery

    nedi, valentines, wine

    Valentine’s Day Gift Guide

    Ella’s Flats Delicious Crackers

    Ella’s Flats Delicious Crackers

    quinoa, salad, vegan, broccoli, asparagus

    11 Sources of Plant Based Protein

    • Fitness
    • Wellness
    • What I’m Loving
    • Interviews
  • Shop
    • Shop My Products
    • Shop Nedi’s Favorites
No Result
View All Result
Healthy with Nedi
No Result
View All Result
Home Recipes Lunch & Dinner

Shrimp Saganaki

Nedi by Nedi
October 20, 2020
in Lunch & Dinner
55 1
0
Shrimp Saganaki
97
SHARES
400
VIEWS
Share on FacebookShare on TwitterShare on Pinterest

Shrimp saganaki is a classical Greek dish that the whole family will love. The most common saganaki recipes can be made with cheese, shrimp or mussels. This is a super easy and delicious appetizer that you can whip up on a busy weeknight. Serve with my Greek orzo salad and a cold glass of ouzo. Yamas!

Shrimp Saganaki

Serves 4

INGREDIENTS

  • 2 tbsp extra-virgin olive oil
  • 4 cups large shrimp (cleaned and deveined)
  • 1 tsp sea salt
  • 1/2 tsp black pepper
  • 1/4 cup ouzo
  • 1 green pepper, thinly sliced
  • 1 red pepper, thinly sliced
  • 1 red onion, finely diced
  • 3 garlic cloves, minced
  • 4 tomatoes, grated
  • 1 cup feta cheese
  • 2 tbsp parsley, chopped

DIRECTIONS

  • STEP 1. Heat a tablespoon of olive oil in a large skillet. Season the shrimp with salt and pepper and add to the skillet. Sauté for 1 minute on each side. Add the ouzo and cook for another minute or two, until the ouzo starts to evaporate. Set aside.
  • STEP 2. Add the remaining of olive oil to a skillet and sauté the peppers and onion for about 2-3 minutes, until they are tender.
  • STEP 3. Add the grated tomatoes and garlic. Cook for about 5 minutes until the sauce starts to thicken.
  • STEP 4. Add the shrimp and garnish with feta cheese. Bring the heat to medium and cover with a lid. Cook for 3-5 more minutes until the feta starts to melt. Garnish the saganaki with chopped parsley and serve with a cold glass of ouzo!

Products/Tools Used In This Recipe:






Tags: appetizerdinnergluten freegreecegreeklunchmediterraneanouzoprawnssaganakishrimptavernavegetables
Previous Post

Gluten Free Orange Cake

Next Post

Cauliflower Tabbouleh

Next Post
Cauliflower Tabbouleh

Cauliflower Tabbouleh

Leave a Reply Cancel reply

Your email address will not be published. Required fields are marked *

Newsletter

Follow & Like

Healthywithnedi.com Notes

All content on healthywithnedi.com is licensed and the original creation and property of Healthy with Nedi LLC, unless otherwise noted. You may use recipes from healthywithnedi.com provided that usage adheres to the following license criteria: I the recipe is credited to healthywithnedi.com by linking back to the original recipe at https://healthywithnedi.com; and II you may not use any recipes for commercial purposes.

As an Amazon Associate, I earn from qualifying purchases.

Photos on healthywithnedi.com may not be used without prior consent.

Recent Posts

Gluten-Free Keto Bread

Gluten-Free Keto Bread

April 10, 2023
Orange Banana Bread with Chocolate Chips

Orange Banana Bread with Chocolate Chips

February 21, 2023
grain-free-eggplant-miso

Miso Glazed Eggplant

November 10, 2022

Navigate

  • Privacy Policy
  • Contact
  • Press

Browse by Category

  • Blog
  • Breakfast
  • Dessert
  • Dinner
  • Dips & Spreads
  • Fitness
  • Greece
  • Interviews
  • Lunch & Dinner
  • Nutrition
  • Recipes
  • Restaurant Guides
  • Side Dishes
  • Skinny Cocktails
  • Smoothies
  • Soups & Salads
  • Travel
  • Uncategorized
  • Vegetarian
  • Warm Drinks
  • Wellness
  • What I’m Loving

© 2022 Healthy with Nedi. All Rights Reserved.

No Result
View All Result
  • About
  • Recipes
    • Breakfast
    • Dessert
    • Dips & Spreads
    • Lunch & Dinner
    • Side Dishes
    • Skinny Cocktails
    • Smoothies
    • Soups & Salads
    • Warm Drinks
  • Work with Me
    • Nutrition
  • Travel
  • Cookbook
  • Blog
    • Fitness
    • Wellness
    • What I’m Loving
    • Interviews
  • Shop
    • Shop Nedi’s Favorites
  • Contact
  • Press

© 2022 Healthy with Nedi. All Rights Reserved.

Welcome Back!

Login to your account below

Forgotten Password?

Retrieve your password

Please enter your username or email address to reset your password.

Log In
Order My New Cookbook Today!
Order Today!
The Mediterranean Meal Plan Cookbook